missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108032

Invitrogen™ Human ASNSD1 (aa 439-521) Control Fragment Recombinant Protein

Catalog No. RP108032
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108032 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108032 Supplier Invitrogen™ Supplier No. RP108032
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67372 (PA5-67372. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASNSD1 (Asparagine Synthetase Domain Containing 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include asparagine synthase (glutamine-hydrolyzing) activity. An important paralog of this gene is ENSG00000286165. [GeneCards]

Specifications

Accession Number Q9NWL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54529
Name Human ASNSD1 (aa 439-521) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ASNSD1; asparagine synthetase domain containing 1; asparagine synthetase domain-containing protein 1; HCV NS3-transactivated protein 1; NBLA00058; NS3TP1
Common Name ASNSD1
Gene Symbol ASNSD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGVKSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less