missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106172

Invitrogen™ Human ASNA1 (aa 25-108) Control Fragment Recombinant Protein

Catalog No. RP106172
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106172 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106172 Supplier Invitrogen™ Supplier No. RP106172
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65495 (PA5-65495. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ASNA1 is the human homolog of the bacterial arsA gene. In E. coli, ArsA ATPase is the catalytic component of a multisubunit oxyanion pump that is responsible for resistance to arsenicals and antimonials.

Specifications

Accession Number O43681
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 439
Name Human ASNA1 (aa 25-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810048H22Rik; ARSA; arsA arsenite transporter, ATP-binding, homolog 1; arsA arsenite transporter, ATP-binding, homolog 1 (bacterial); ARSA1; ARSA-I; Arsenical pump-driving ATPase; Arsenical resistance ATPase; arsenite-stimulated ATPase; arsenite-translocating ATPase; Arsenite-transporting ATPase; asna1; ASNA-I; ATPase asna1; ATPase GET3; GET3; guided entry of tail-anchored proteins factor 3, ATPase; hARSA-I; hASNA-I; MGC3821; si:dkey-121b10.2; Transmembrane domain recognition complex 40 kDa ATPase subunit; TRC40; wu:fd05d03; zgc:56540; zgc:56540 protein; zgc:86799
Common Name ASNA1
Gene Symbol GET3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less