missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107336

Invitrogen™ Human ASK1 (aa 1287-1374) Control Fragment Recombinant Protein

Catalog No. RP107336
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107336 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107336 Supplier Invitrogen™ Supplier No. RP107336

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP3K5 (ASK1) is a serine/threonine kinase that is abundantly expressed in human heart and pancreas and are activated in response to various extracellular stimuli, including cytokines, growth factors and environmental stresses. A novel MAP kinase kinase kinase (MAPKKK) was identified and designated ASK1 (for apoptosis signal-regulating kinase 1) and MAPKKK5. ASK1 activates two different subgroups of MAPKK, MKK4 and MKK6, which in turn activates c-Jun N-terminal kinase (JNK) and p38 MAP kinase, respectively. ASK1/MAPKKK5 is activated by TNFR and Fas through the interaction with members of the TRAF family and Fas-associated protein Daxx. Overexpression of ASK1 induced apoptotic cell death and a catalytically inactive form of ASK1 inhibited TNF-a-induced apoptosis. ASK1 is expressed in variety of human and mouse tissues.

Specifications

Accession Number Q99683
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4217
Name Human ASK1 (aa 1287-1374) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 7420452D20Rik; apoptosis signal regulating kinase 1; apoptosis signal-regulating kinase 1; ASK; ASK 1; ASK1; ASK-1; EC 2.7.11.25; kinase ASK1; M3K5; MAP/ERK kinase kinase 5; Map3k5; MAPK/ERK kinase kinase 5; MAPKKK5; MEK kinase 5; MEKK 5; Mekk5; mitogen activated protein kinase kinase kinase 5; mitogen-activated protein kinase kinase kinase 5; RGD1306565; RP3-325F22.4
Common Name ASK1
Gene Symbol MAP3K5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less