missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89526

Invitrogen™ Human ARPC2 (aa 162-300) Control Fragment Recombinant Protein

Catalog No. RP89526
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89526 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89526 Supplier Invitrogen™ Supplier No. RP89526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82347 (PA5-82347. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.

Specifications

Accession Number O15144
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10109
Name Human ARPC2 (aa 162-300) Control Fragment
Quantity 100 μL
Gene Alias 2210023N03Rik; 34 kDa; actin related protein 2/3 complex subunit 2; actin related protein 2/3 complex subunit 2, 34 kDa; actin related protein 2/3 complex, subunit 2; actin related protein 2/3 complex, subunit 2, 34 kDa; actin-related protein 2/3 complex subunit 2; actin-related protein 2/3 complex subunit 2 {ECO:0000250; ARC34; Arp2/3 complex 34 kDa subunit; arp2/3 complex 34 kDa subunit {ECO:0000250; ARP2/3 protein complex subunit 34; ARPC2; arpc2 {ECO:0000250; p34-ARC; p34-ARC {ECO:0000250; PNAS-139; PRO2446; testis tissue sperm-binding protein Li 53 e; UniProtKB:O15144}
Common Name ARPC2
Gene Symbol ARPC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less