missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ARMX3 (aa 253-373) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91937
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51493 (PA5-51493. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene.Specifications
| Q9UH62 | |
| Blocking Assay, Control | |
| 51566 | |
| 100 μL | |
| 1200004E24Rik; AI450003; ALEX3; ARM protein lost in epithelial cancers on chromosome x 3; arm protein lost in epithelial cancers, x chromosome, 3; armadillo repeat containing X-linked 3; armadillo repeat containing, X-linked 3; armadillo repeat-containing X-linked protein 3; armadillo repeat-containing X-linked protein 3-like protein; Armcx3; BM-017; dJ545K15.2; DKFZp781N1954; GASP6; KIAA0443; MGC12199; Protein ALEX3; UNQ2517/PRO6007 | |
| ARMCX3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ARMX3 (aa 253-373) Control Fragment | |
| RUO | |
| ARMX3 | |
| Unconjugated | |
| Recombinant | |
| SAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |