missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96970

Invitrogen™ Human ARHGEF37 (aa 181-250) Control Fragment Recombinant Protein

Catalog No. RP96970
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96970 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96970 Supplier Invitrogen™ Supplier No. RP96970
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60542 (PA5-60542. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a guanine nucleotide exchange factor (GEF).

Specifications

Accession Number A1IGU5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 389337
Name Human ARHGEF37 (aa 181-250) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933429F08Rik; ARHGEF37; probable guanine nucleotide exchange factor FLJ41603 homolog; protein 2-88; RGD1560471; Rho guanine nucleotide exchange factor (GEF) 37; Rho guanine nucleotide exchange factor 37; Scaffold protein tuba 3
Common Name ARHGEF37
Gene Symbol ARHGEF37
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINTHTLSKKTTRL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less