missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105996

Invitrogen™ Human ARHGEF33 (aa 139-202) Control Fragment Recombinant Protein

Catalog No. RP105996
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105996 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105996 Supplier Invitrogen™ Supplier No. RP105996
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83532 (PA5-83532. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a guanine-nucleotide releasing factor.

Specifications

Accession Number A8MVX0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 100271715
Name Human ARHGEF33 (aa 139-202) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ARHGEF33; DH and coiled-coil domain-containing protein ENSP00000381780; Rho guanine nucleotide exchange factor (GEF) 33; Rho guanine nucleotide exchange factor 33
Common Name ARHGEF33
Gene Symbol ARHGEF33
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less