missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102828

Invitrogen™ Human ARHGAP32 (aa 1076-1170) Control Fragment Recombinant Protein

Catalog No. RP102828
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102828 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102828 Supplier Invitrogen™ Supplier No. RP102828
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58365 (PA5-58365. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GTPase-activating protein (GAP) promoting GTP hydrolysis on RHOA, CDC42 and RAC1 small GTPases. May be involved in the differentiation of neuronal cells during the formation of neurite extensions. Involved in NMDA receptor activity-dependent actin reorganization in dendritic spines. May mediate cross-talks between Ras- and Rho regulated signaling pathways in cell growth regulation. Isoform 2 has higher GAP activity.

Specifications

Accession Number A7KAX9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9743
Name Human ARHGAP32 (aa 1076-1170) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3426406O18Rik; 6430596G11Rik; AI841135; ARHGAP32; Arhgap35; brain-specific Rho GTP-ase-activating protein; brain-specific Rho GTPase-activating protein; BRF2; butyrate response factor 2; EGF-response factor 2; ERF2; ERF-2; GAB-associated CDC42; GAB-associated Cdc42/Rac GTPase-activating protein; GAP-associated protein p190; Gc-gap; glucocorticoid receptor DNA binding factor 1; glucocorticoid receptor DNA-binding factor 1; Glucocorticoid receptor repression factor 1; GRF1; GRF-1; Grit; Grlf1; GTPase regulator interacting with TrkA; GTPase-activating protein for Cdc42 and Rac1; KIAA0712; KIAA1722; mKIAA0712; mKIAA1722; mRNA decay activator protein ZFP36L2; P190 RhoGAP; p190A; p190-A; p190ARHOGAP; p190RhoGAP; p200RhoGAP; p250Gap; PX-RICS; rac GTPase activating protein; rho GAP p190A; Rho GTPase activating protein 32; Rho GTPase activating protein 33 pseudogene; Rho GTPase activating protein 35; rho GTPase-activating protein 32; Rho GTPase-activating protein 35; Rho/Cdc42/Rac GTPase-activating protein RICS; rhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling; RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling; rho-type GTPase-activating protein 32; RICS; RNF162C; TIS11D; TPA-induced sequence 11 d; ZFP36 ring finger protein like 2; ZFP36 ring finger protein-like 2; Zfp36l2; ZFP36-like 2; zinc finger protein 36, C3H type-like 1; zinc finger protein 36, C3H type-like 2; zinc finger protein 36, C3H type-like 2-like; zinc finger protein 36, C3H1 type-like 2; zinc finger protein, C3H type, 36-like 2
Common Name ARHGAP32
Gene Symbol ARHGAP32
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less