missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human AQP11 (aa 132-165) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109880
Description
Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145163 (PA5-145163. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Aqp11 encodes aquaporins (AQPs) that are integral membrane proteins that facilitate the transport of water across biological membranes along an osmotic gradient. There have been 13 AQP isoforms (AQP0-AQP12) identified in humans and rodents to date. Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.Specifications
| Q8NBQ7 | |
| Blocking Assay, Control | |
| 282679 | |
| 100 μL | |
| 1700015P13Rik; AI648923; AQP11; AQP-11; AQPX1; aquaporin 11; aquaporin-11; CG12251 gene product; PSEC0027; sjds | |
| AQP11 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human AQP11 (aa 132-165) Control Fragment | |
| RUO | |
| AQP11 | |
| Unconjugated | |
| Recombinant | |
| RYCTSALWSLGLTQYHVSERSFACKNPIRVDLLK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |