missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105962

Invitrogen™ Human APBA2 (aa 94-175) Control Fragment Recombinant Protein

Catalog No. RP105962
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105962 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105962 Supplier Invitrogen™ Supplier No. RP105962
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139840 (PA5-139840. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

APBA2, a member of the X11 protein family, is a phosphotyrosine-binding domain protein and is a neuronal adapter protein that interacts with amyloid precursor protein (APP) and neuritic plaques in the brains of patients with Alzheimer's disease. It stabilizes APP and inhibits production of proteolytic APP fragments including the Abeta peptide that is deposited in the brains of Alzheimer's disease patients. APBA2 is believed to be involved in signal transduction processes and is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion. Recent reports suggest that it may also be a candidate gene for autism.

Specifications

Accession Number Q99767
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 321
Name Human APBA2 (aa 94-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Adapter protein X11 beta; amyloid beta (A4) precursor protein-binding family A member 2 ( x 11-like); amyloid beta (A4) precursor protein-binding, family A, member 2; amyloid beta (A4) precursor protein-binding, family A, member 2 ( x 11-like); amyloid beta A4 precursor protein-binding family A member 2; amyloid beta precursor protein binding family A member 2; Amyloid-beta A4 precursor protein-binding family A member 2; Apba2; D15S1518E; HsT16821; LIN-10; MGC:14091; Mint 2; Mint2; mint-2; mXllL; Neuronal Munc18-1-interacting protein 2; neuron-specific X11 L protein; phosphotyrosine-binding/-interacting domain (PTB)-bearing protein; X11-BETA; X11 L; X11-like; X11-like protein; XllL
Common Name APBA2
Gene Symbol APBA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEGITYYIRYCPEDDSYLEGMDCNGEEYLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less