missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AP4M1 (aa 196-266) Control Fragment Recombinant Protein

Catalog No. RP107517
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107517 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107517 Supplier Invitrogen™ Supplier No. RP107517

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84736. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of the heterotetrameric AP-4 complex. The encoded protein belongs to the adaptor complexes medium subunits family. This AP-4 complex is involved in the recognition and sorting of cargo proteins with tyrosine-based motifs from the trans-Golgi network to the endosomal-lysosomal system.

Specifications

Accession Number O00189
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9179
Name Human AP4M1 (aa 196-266) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4930443L05Rik; adapter-related protein complex 4 mu-1 subunit; adapter-related protein complex 4 subunit mu-1; adaptor related protein complex 4 mu 1 subunit; adaptor related protein complex 4, mu 1 subunit; adaptor-related protein complex 4 subunit mu-1; adaptor-related protein complex 4, mu 1 subunit; adaptor-related protein complex AP-4 mu4 subunit; adaptor-related protein complex AP-4, mu 1; AP-4 adapter complex mu subunit; AP-4 adaptor complex mu subunit; AP-4 complex subunit mu-1; Ap4m1; ap4m1 {ECO:0000312; Ap4m4; CPSQ3; Mu subunit of AP-4; mu4; MU-4; mu4-adaptin; Mu-adaptin-related protein 2; mu-adaptin-related protein-2; MUARP2; mu-ARP2; RGD:1310233}; SPG50
Common Name AP4M1
Gene Symbol AP4M1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFES
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less