missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89916

Invitrogen™ Human Annexin A1 (aa 1-102) Control Fragment Recombinant Protein

Catalog No. RP89916
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89916 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89916 Supplier Invitrogen™ Supplier No. RP89916

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Annexin I belongs to a family of Ca (2+) -dependent phospholipid binding proteins that are preferentially located on the cytosolic face of the plasma membrane. Annexin I has a molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Specifications

Accession Number P04083
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 301
Name Human Annexin A1 (aa 1-102) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias ANAX1; Annexin 1 (p35) (Lipocortin 1); annexin A1; Annexin I; annexin I (lipocortin I); annexin-1; ANX1; Anx-1; Anxa1; Anx-A1; C430014K04Rik; Calpactin II; calpactin-2; Chromobindin-9; lipocortin 1; lipocortin I; LPC1; Lpc-1; p35; Phospholipase A2 inhibitory protein; RP11-71A24.1
Common Name Annexin A1
Gene Symbol ANXA1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less