missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ANKRA2 (aa 1-71) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107415
Description
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66758 (PA5-66758. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This protein may facilitate endocytosis by linking megalin to components of the cytoskeleton or endocytic machinery. ANKRA2 is a megalin- and BKCa potassium channel-interacting factor. It is a protein known to interact with HDAC4 and HDAC5.ANKRA2 is important for transcriptional repression by AhRR.Specifications
| Q9H9E1 | |
| Blocking Assay, Control | |
| 57763 | |
| 100 μL | |
| 1110004M18Rik; ANKRA; ANKRA2; ankyrin repeat family A member 2; ankyrin repeat family A protein 2; ankyrin repeat family A protein 2-like protein; ankyrin repeat, family A (RFXANK-like), 2; ankyrin-repeat family A protein; RFXANK-like protein 2; similar to SLO-interacting ankyrin-containing protein; SLO-interacting ankyrin-containing protein; wu:fd08c02; zgc:64138 | |
| ANKRA2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ANKRA2 (aa 1-71) Control Fragment | |
| RUO | |
| ANKRA2 | |
| Unconjugated | |
| Recombinant | |
| MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |