missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94088

Invitrogen™ Human AMPD1 (aa 8-88) Control Fragment Recombinant Protein

Catalog No. RP94088
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94088 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94088 Supplier Invitrogen™ Supplier No. RP94088
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55761 (PA5-55761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AMP deaminase (AMPD) is an allosteric enzyme involved in the regulation of adenosine metabolism. It catalyzes a central reaction in purine nucleotide biosynthesis where AMP is deaminated to IMP, liberating ammonia. There are three functional isoforms of AMPD. AMPD1 (E.C. No 3.5.4.6.) is the skeletal muscle-specific isoform M located in type II muscle fibers, neuromuscular junctions and in capillaries. This protein is the predominant member of AMPD multi-gene family and is considered as the sensor of the cell’s changing energy requirements. AMPD1 deficiency causes irregular muscle metabolism due to lower rate of ATP degradation, phosphocreatine hydrolysis and accumulation of lactic acid. Mutated AMPD1 expression has been detected in neuromuscular disorders, exercise-induced skeletal muscle myopathies and congestive heart failures due to coronary artery diseases.

Specifications

Accession Number P23109
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 270
Name Human AMPD1 (aa 8-88) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias adenosine monophosphate deaminase 1; adenosine monophosphate deaminase 1 (isoform M); adenosine monophosphate deaminase-1 (muscle); AI553520; AMP deaminase 1; AMP deaminase isoform M; Ampd; Ampd01; AMPD1; Ampd-1; MAD; MADA; MMDD; myoadenylate deaminase; RATAMPD01; RP5-1000E10.1; skeletal muscle AMPD
Common Name AMPD1
Gene Symbol AMPD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKRFQGRKTVNLSIPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less