missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90085

Invitrogen™ Human Alpha Sarcoglycan (aa 177-289) Control Fragment Recombinant Protein

Catalog No. RP90085
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90085 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90085 Supplier Invitrogen™ Supplier No. RP90085

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52450 (PA5-52450. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The sarcoglycan transmembrane proteins are members of the dystrophin complex. Sarcoglycans cluster together to form a complex, which is localized in the cell membrane of skeletal, cardiac, and smooth muscle fibers. Four sarcoglycan subunit proteins, designated alpha-, beta-, gamma- and delta-sarcoglycan, form a complex on the skeletal muscle cell surface membrane. A genetic defect in any one of these proteins causes the loss or marked decrease of the whole sarcoglycan complex, which is observed in the autosomal recessive muscular dystrophy, sarcoglycanopathy. In smooth muscle, beta- and delta-sarcoglycans are associated with epsilon-sarcoglycan, a glycoprotein homologous to alpha-sarcoglycan. Additionally, a complete deficiency in delta-sarcoglycan is the cause of the Syrian hamster BIO.14 cardiomyopathy.

Specifications

Accession Number Q16586
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6442
Name Human Alpha Sarcoglycan (aa 177-289) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 50 kDa dystrophin-associated glycoprotein; 50 DAG; 50 kD DAG; adhalin; ADL; Alpha-sarcoglycan; alpha-SG; Asg; DAG2; DMDA2; Dystroglycan 2; Dystroglycan2; dystroglycan-2; LGMD2D; limb girdle muscular dystrophy 2 D; sarcoglycan alpha; sarcoglycan, alpha (50 kDa dystrophin-associated glycoprotein); sarcoglycan, alpha (dystrophin-associated glycoprotein); SCARMD1; SG alpha; SG-alpha; Sgca
Common Name Alpha Sarcoglycan
Gene Symbol SGCA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less