missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ALDH3A1 (aa 52-105) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105287
Description
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84620 (PA5-84620. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Aldh3A1 is a member of the aldehyde dehydrogenase superfamily, a group of NAD(P)(+)-dependent enzymes that catalyze the oxidation of a wide spectrum of aliphatic and aromatic aldehydes. Aldh3A1 is highly expressed in stomach and even more strongly in cornea, representing between 5 to 50% of the water soluble protein fraction in mammalian corneas. It is thought that Aldh3A1 acts to protect the cornea from UV-induced oxidative stress by not only detoxification of reactive aldehydes by also through the direct absorption of UV energy. However, corneas from Aldh3A1-null mice are indistinguishable from those from wild-type mice; mice lacking both Aldh3A1 and Aldh1A1 showed increased cataract formation following UVB exposure, suggesting that Aldh1A1 may be able to compensate for the loss of Aldh3A1.Specifications
| P30838 | |
| Blocking Assay, Control | |
| 218 | |
| 100 μL | |
| Ahd4; Ahd-4; AHDC; Ahd-c; alcohol dehydrogenase family 3, subfamily A1; Aldd; Aldehyde dehydrogenase (Ahd-c); Aldehyde dehydrogenase 3; aldehyde dehydrogenase 3 family member A1; aldehyde dehydrogenase 3 family, member A1; aldehyde dehydrogenase 3 family, memberA1; aldehyde dehydrogenase 3, stomach cytosolic (class 3); aldehyde dehydrogenase 3A1; aldehyde dehydrogenase 4; aldehyde dehydrogenase class 3; aldehyde dehydrogenase family 3 member A1; aldehyde dehydrogenase family 3 subfamily A1; aldehyde dehydrogenase family 3, member A1; aldehyde dehydrogenase family 3, subfamily A1; aldehyde dehydrogenase isozyme 3; aldehyde dehydrogenase type III; aldehyde dehydrogenase, dimeric NADP-preferring; Aldh; Aldh3; Aldh3a1; Aldh4; ALDHIII; BCP54; bovine corneal protein 54; corneal 15.8 kDa protein; corneal epithelium; corneal protein 54, transparentin; dehydrogenase 3, dimeric NAPD-prefering; dioxin-inducible aldehyde dehydrogenase 3; HTC-ALDH; MGC10406; stomach aldehyde dehydrogenase; transparentin; Tumor-associated aldehyde dehydrogenase; tumor-associated aldehyde dehydrogenase tumor ALDH | |
| ALDH3A1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ALDH3A1 (aa 52-105) Control Fragment | |
| RUO | |
| ALDH3A1 | |
| Unconjugated | |
| Recombinant | |
| LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |