missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97128

Invitrogen™ Human AKR1E2 (aa 105-168) Control Fragment Recombinant Protein

Catalog No. RP97128
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97128 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97128 Supplier Invitrogen™ Supplier No. RP97128

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58123 (PA5-58123. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the aldo-keto reductase superfamily. Members in this family are characterized by their structure (evolutionarily highly conserved TIM barrel) and function (NAD(P)H-dependent oxido-reduction of carbonyl groups). Transcripts of this gene have been reported in specimens of human testis. Alternative splicing results in multiple transcript variants.

Specifications

Accession Number Q96JD6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83592
Name Human AKR1E2 (aa 105-168) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1,5-anhydro-D-fructose reductase; AF reductase; Akr1cl2; Akr1e1; Akr1e2; AKRDC1; Aldo-keto reductase family 1 member C-like protein 2; aldo-keto reductase family 1 member E2; aldo-keto reductase family 1, member C-like 2; aldo-keto reductase family 1, member E1; aldo-keto reductase family 1, member E2; aldo-keto reductase loopADR; htAKR; hTSP; LoopADR; Testis aldo-keto reductase; Testis-specific protein
Common Name AKR1E2
Gene Symbol AKR1E2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less