missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Akirin1 (aa 68-133) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101506
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62506 (PA5-62506. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The highly conserved, nuclear-localized Akirin1 and Akirin2 proteins critically regulate the transcription of NF-kappa-B-dependent genes and are required for defense against Gram-negative bacteria in the immune deficiency and NF-kappa-B pathways. Akirin1 is dispensable in the mouse, and neither knockout mice nor cells derived from them have obvious distinctive phenotypes. In contrast, Akirin2 is required for development in the mouse and knockout of both Akirin homologs in mice show that Akirin2 is required downstream of toll-like receptor (TLR), TNF-a and IL-1-b signaling, and for the production of IL-6. Akirin2 is functionally closer to the single gene in Drosophila, as the homozygous null D. melanogaster Akirin mutants show a similar, mid-to-early embryonic death.Specifications
| Q9H9L7 | |
| Blocking Assay, Control | |
| 79647 | |
| 100 μL | |
| 6330407G11Rik; akirin 1; AKIRIN1; akirin-1; C1orf108; Mighty; Mighty protein; MNCb-2831; RP11-781D11.2; STRF2 | |
| AKIRIN1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Akirin1 (aa 68-133) Control Fragment | |
| RUO | |
| AKIRIN1 | |
| Unconjugated | |
| Recombinant | |
| RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |