missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107059

Invitrogen™ Human AKIP1 (aa 13-74) Control Fragment Recombinant Protein

Catalog No. RP107059
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107059 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107059 Supplier Invitrogen™ Supplier No. RP107059
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66385 (PA5-66385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Enhances NF-kappa-B transcriptional activity by regulating the nuclear localization of the NF-kappa-B subunit RELA and promoting the phosphorylation of RELA by PRKACA. Regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade.

Specifications

Accession Number Q9NQ31
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56672
Name Human AKIP1 (aa 13-74) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A kinase (PRKA) interacting protein 1; A-kinase interacting protein 1; A-kinase-interacting protein 1; Akip1; BCA3; breast cancer associated 3; breast cancer associated gene 3; breast cancer-associated gene 3 protein; C11orf17; D7H11orf17; D930014E17Rik; ICRFP703B1614Q5.6; ICRFP703N2430Q5.6; koyt binding protein 1; koyt binding protein 2; koyt binding protein 3; ORF27; Pk.-interacting protein; Proline-rich protein BCA3; protein kinase A-interacting protein 1; RGD1306959
Common Name AKIP1
Gene Symbol Akip1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRVLPGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less