missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AKAP4 (aa 547-691) Control Fragment Recombinant Protein

Catalog No. RP92144
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92144 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92144 Supplier Invitrogen™ Supplier No. RP92144

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP4, also known as hAKAP82, is a major sperm fibrous sheath protein that localizes to the entire length of the flagellum of human sperm. It has been suggested that AKAP4 plays multiple roles in sperm motility and regulation of signal transduction pathways. AKAP4 has also been postulated to be a potential biomarker for breast cancer.

Specifications

Accession Number Q5JQC9
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 8852
Name Human AKAP4 (aa 547-691) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 75 kDa fibrous sheath protein; A kinase (PRKA) anchor protein 4; AKAP 82; AKAP4; AKAP-4; akap4 {ECO:0000312; AKAP82; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; A-kinase anchoring protein 4; cancer/testis antigen 99; CT99; Fsc1; hAKAP82; HI; major sperm fibrous sheath protein; mAKAP82; p82; PRKA4; protein kinase A anchoring protein 4; protein kinase A-anchoring protein 4; RGD:620828}; testis-specific gene HI
Common Name AKAP4
Gene Symbol AKAP4
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less