missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97690

Invitrogen™ Human AKAP3 (aa 540-632) Control Fragment Recombinant Protein

Catalog No. RP97690
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97690 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97690 Supplier Invitrogen™ Supplier No. RP97690
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58920 (PA5-58920. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The type II cAMP-dependent protein kinase (PKA) is a multifunctional kinase with a broad range of substrates. Specificity of PKA signaling is mediated by the compartmentalization of the kinase to specific sites within the cell. To maintain this specific localization, the R subunit (RII) of PKA interacts with specific RII-anchoring proteins, designated A-kinase anchoring proteins (AKAP). AKAP 3, also known as AKAP 110, FSP95, PRKA3 and SOB1, binds both PKA and PDE4A and functions as a scaffolding protein in spermatozoa to regulate local cAMP concentrations and modulate sperm functions. Expression of AKAP 3 in normal tissues is restricted to the testis, where bicarbonate stimulates tyrosine phosphorylation of AKAP 3, thereby increasing its recruitment of PKA. AKAP-3 also exhibits high expression in patients with epithelial ovarian cancer (EOC). It demonstrates tumor-restricted expression and appears to be associated with worse overall survival, which make AKAP 3 a potential target for antigen-specific immunotherapy in EOC.

Specifications

Accession Number O75969
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10566
Name Human AKAP3 (aa 540-632) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A kinase (PRKA) anchor protein 3; AKAP 110; AKAP110; Akap3; AKAP-3; A-kinase anchor protein 110 kDa; A-kinase anchor protein 3; A-kinase anchor protein, 110 kDa; A-kinase anchoring protein 3; Cancer/testis antigen 82; CT82; epididymis luminal protein 159; Fibrous Sheath Protein of 95 kDa; fibrousheathin 1; Fibrousheathin I; fibrousheathin-1; FSP95; HEL159; PRKA3; protein kinase A binding protein AKAP 110; Protein kinase A-anchoring protein 3; SOB1; Sperm oocyte-binding protein; sperm oocyte-binding protein 1
Common Name AKAP3
Gene Symbol AKAP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less