missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human AKAP14 (aa 2-52) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101570
Description
Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63918 (PA5-63918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The protein anchors PKA in ciliary axonemes and, in this way, may play a role in regulating ciliary beat frequency. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.Specifications
| Q86UN6 | |
| Blocking Assay, Control | |
| 158798 | |
| 100 μL | |
| A kinase (PRKA) anchor protein 14; AKAP 28; AKAP14; AKAP-14; AKAP28; A-kinase anchor protein 14; A-kinase anchor protein 28 kDa; A-kinase anchoring protein 14; A-kinase anchoring protein 28; PRKA14; Protein kinase A-anchoring protein 14; TAKAP-1.2; Takap80; Testis-specific A-kinase-anchoring protein TAKAP-80; Testis-specific A-kinase-anchoring-protein | |
| AKAP14 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human AKAP14 (aa 2-52) Control Fragment | |
| RUO | |
| AKAP14 | |
| Unconjugated | |
| Recombinant | |
| SETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |