missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102397

Invitrogen™ Human AKAP10 (aa 212-341) Control Fragment Recombinant Protein

Catalog No. RP102397
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102397 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102397 Supplier Invitrogen™ Supplier No. RP102397

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56007. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The A-kinase anchor proteins are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein interacts with both the type I and type II regulatory subunits of PKA; therefore, it is a dual-specific AKAP. This protein is highly enriched in mitochondria. It contains RGS domains, in addition to a PKA-RII subunit-binding domain. The mitochondrial localization and the presence of RGS domains may have important implications for the function of this protein in PKA and G protein signal transduction.

Specifications

Accession Number O43572
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 11216
Name Human AKAP10 (aa 212-341) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 1500031L16Rik; A kinase (PRKA) anchor protein 10; A kinase anchor protein 10; A kinase anchor protein 10, mitochondrial; Akap10; AKAP-10; A-kinase anchor protein 10, mitochondrial; A-kinase anchoring protein 10; B130049N18Rik; D-akap2; D-AKAP-2; Dual specific A kinase anchoring protein 2; dual specificity A kinase-anchoring protein 2; MGC9414; mitochondrial A kinase PPKA anchor protein 10; PRKA10; protein kinase A anchoring protein 10; protein kinase A-anchoring protein 10
Common Name AKAP10
Gene Symbol AKAP10
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SAQLFMTHSEGIDLNNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVNTFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less