missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AHNAK (aa 4990-5113) Control Fragment Recombinant Protein

Catalog No. RP92504
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92504 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92504 Supplier Invitrogen™ Supplier No. RP92504

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53912 (PA5-53912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AHNAK1 (Desmoyokin) is a large (700 kDa) scaffold protein that translocates to the plasma membrane after an increas of extracellular calcium level or upon proteinkinase C activation and regulates extracellular calcium influx mediated by L-type Ca2+ channels. AHNAK1 has been implicated in diverse signal transduction proceses affecting cell differentiation and proliferation. In response to calcium-dependent intercellular contacts AHNAK1 forms multimeric complexes in the plasma membrane, connected with actin and annexin 2/S100A10 assemblies and is thus involved in organization of the plasma membrane architecture. In epithelial cells, AHNAK1 is localized in cytoplasm or is membrane-associated, but in cells of nonepithelial origin AHNAK1 is predominantly nuclear; it has a weak DNA-binding activity and associates with the DNA-ligase IV-XRCC4 complex.

Specifications

Accession Number Q09666
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79026
Name Human AHNAK (aa 4990-5113) Control Fragment
Quantity 100 μL
Gene Alias AHNAK; AHNAK 1; AHNAK nucleoprotein; AHNAK nucleoprotein (desmoyokin); AHNAK-related; AHNAKRS; Desmoyokin; DY6; MGC5395; Neuroblast differentiation-associated protein AHNAK; PM227; RGD1308572; UV118
Common Name AHNAK
Gene Symbol AHNAK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DIKSPSLDVTVPEAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKKQGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFKAEAPLPSPKL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less