missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human AGPAT9 (aa 41-131) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP90973
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56137 (PA5-56137. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the lysophosphatidic acid acyltransferase protein family. The encoded protein is an enzyme which catalyzes the conversion of glycerol-3-phosphate to lysophosphatidic acid in the synthesis of triacylglycerol. Multiple alternatively spliced variants, encoding the same protein, have been identified.Specifications
| Q53EU6 | |
| Blocking Assay, Control | |
| 84803 | |
| 100 μL | |
| 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-acylglycerol-3-phosphate O-acyltransferase 9; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT; 1-AGPAT 9; 4933407I02Rik; 4933408F15; 9; A230097K15Rik; acyl-CoA:glycerol-3-phosphate acyltransferase 3; AGPAT 10; AGPAT10; AGPAT8; AGPAT9; endoplasmic reticulum associated GPAT; glycerol-3-phosphate acyltransferase 3; GPAT3; GPAT-3; hGPAT3; HMFN0839; LPAAT-theta; lung cancer metastasis-associated protein 1; Lysophosphatidic acid acyltransferase theta; lysophosphatidic acid acyltransferase, theta; MAG1; MAG-1; mGPAT3; testis secretory sperm-binding protein Li 213 e; UNQ2753/PRO6492 | |
| GPAT3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human AGPAT9 (aa 41-131) Control Fragment | |
| RUO | |
| AGPAT9 | |
| Unconjugated | |
| Recombinant | |
| ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |