missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADCK4 (aa 292-356) Control Fragment Recombinant Protein

Catalog No. RP95207
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95207 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95207 Supplier Invitrogen™ Supplier No. RP95207

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55551 (PA5-55551. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein with two copies of a domain found in protein kinases. The encoded protein has a complete protein kinase catalytic domain, and a truncated domain that contains only the active and binding sites of the protein kinase domain, however, it is not known whether the protein has any kinase activity. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number Q96D53
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79934
Name Human ADCK4 (aa 292-356) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610012P18Rik; aarF domain containing kinase 4; aarF domain-containing protein kinase 4; ADCK4; Atypical kinase COQ8B, mitochondrial; Coenzyme Q protein 8 B; coenzyme Q8B; COQ8B; FLJ12229; NPHS9
Common Name ADCK4
Gene Symbol COQ8B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ACAQNFRQLLANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less