missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99241

Invitrogen™ Human ADAT3 (aa 263-348) Control Fragment Recombinant Protein

Catalog No. RP99241
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99241 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99241 Supplier Invitrogen™ Supplier No. RP99241
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63626 (PA5-63626. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a subunit of a tRNA-specific adenosine deaminase. This heterodimeric enzyme converts adenosine to inosine in the tRNA anticodon. A mutation in this gene causes a syndrome characterized by intellectual disability and strabismus. This gene shares its 5' exon with the overlapping gene, secretory carrier membrane protein 4. ADAT3 (Adenosine Deaminase TRNA Specific 3) is a Protein Coding gene. Diseases associated with ADAT3 include Neurodevelopmental Disorder With Brain Abnormalities, Poor Growth, And Dysmorphic Facies and Cone-Rod Dystrophy 10. Among its related pathways are tRNA processing and Processing of Capped Intron-Containing Pre-mRNA. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is ADAT2.

Specifications

Accession Number Q96EY9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 113179
Name Human ADAT3 (aa 263-348) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ADAT3; adenosine deaminase, tRNA specific 3; adenosine deaminase, tRNA-specific 3; adenosine deaminase, tRNA-specific 3, TAD3 homolog; FWP005; MRT36; MST121; MSTP121; Probable inactive tRNA-specific adenosine deaminase-like protein 3; S863-5; TAD3; tRNA-specific adenosine deaminase 3 homolog; tRNA-specific adenosine deaminase-like protein 3; tRNA-specific adenosine-34 deaminase subunit ADAT3
Common Name ADAT3
Gene Symbol ADAT3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less