missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAT1 (aa 7-98) Control Fragment Recombinant Protein

Catalog No. RP98538
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98538 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98538 Supplier Invitrogen™ Supplier No. RP98538
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83511 (PA5-83511. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Specifications

Accession Number Q9BUB4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23536
Name Human ADAT1 (aa 7-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Adat1; Adenosine deaminase; adenosine deaminase acting on tRNA; adenosine deaminase tRNA specific 1; adenosine deaminase, tRNA specific 1; adenosine deaminase, tRNA-specific 1; HADAT1; mADAT1; MMADAT1; tRNA-specific 1; tRNA-specific adenosine deaminase 1; tRNA-specific adenosine-37 deaminase; zgc:162299
Common Name ADAT1
Gene Symbol ADAT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less