missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ACYP1 (aa 1-97) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP89113
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57089 (PA5-57089. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis.Specifications
| P07311 | |
| Blocking Assay, Control | |
| 97 | |
| 100 μL | |
| 1110039O14Rik; acylphosphatase 1; acylphosphatase 1, erythrocyte (common) type; acylphosphatase, erythrocyte isozyme; Acylphosphatase, organ-common type isozyme; acylphosphatase-1; Acylphosphate phosphohydrolase 1; Acyp1; ACYPE; AI325944 | |
| ACYP1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ACYP1 (aa 1-97) Control Fragment | |
| RUO | |
| ACYP1 | |
| Unconjugated | |
| Recombinant | |
| MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |