missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89760

Invitrogen™ Human ACVRL1 (aa 22-119) Control Fragment Recombinant Protein

Catalog No. RP89760
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89760 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89760 Supplier Invitrogen™ Supplier No. RP89760

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Activin A receptor type II-like 1 (ACVRL1) is a type I cell-surface receptor for the TGF-beta superfamily of ligands. ACVRL1, similar to other type 1 receptors, has a conserved serine-threonine kinase subdomain, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. Mutations in ACVRL1 are associated with hemorrhagic telangiectasia type 2. Mutations in ACVRL1 have been linked to Fibrodysplasia Ossificans Progressiva (FOP), a rare genetic disorder characterized by the formation of bone in muscles, tendons, and other connective tissues, as well as Epicanthus.

Specifications

Accession Number P37023
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 94
Name Human ACVRL1 (aa 22-119) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias activin A receptor like type 1; activin A receptor type II-like 1; activin A receptor type IL; activin A receptor, type II-like 1; activin A receptor, type II-like kinase 1; Activin receptor like kinase 1; activin receptor-like kinase 1; activin receptor-like kinase-1; Acvrl1; Acvrlk1; AI115505; AI427544; ALK1; ALK-1; HHT; HHT2; ORW2; R3; R-3; Serine/threonine-protein kinase receptor R3; SETHKIR; SKR3; TGF-B superfamily receptor type I; TSR-I
Common Name ACVRL1
Gene Symbol ACVRL1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less