missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ACSS2 (aa 130-278) Control Fragment Recombinant Protein

Catalog No. RP102332
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102332 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102332 Supplier Invitrogen™ Supplier No. RP102332

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52059 (PA5-52059. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein with a sterol sensing domain (SSD) and seven WD domains. In the presence of cholesterol, this protein binds to sterol regulatory element binding proteins (SREBPs) and mediates their transport from the ER to the Golgi. The SREBPs are then proteolytically cleaved and regulate sterol biosynthesis.

Specifications

Accession Number Q9NR19
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55902
Name Human ACSS2 (aa 130-278) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110017C11Rik; ACAS; Acas1; Acas2; ACECS; AceCS1; acetate thiokinase; acetate-CoA ligase; acetate--CoA ligase; Acetyl-CoA synthetase; Acetyl-CoA synthetase 1; acetyl-Coenzyme A synthetase 1 (AMP forming); acetyl-Coenzyme A synthetase 2 (ADP forming); acetyl-Coenzyme A synthetase 2 (AMP forming); acetyl-coenzyme A synthetase, cytoplasmic; ACS; Acs1; ACSA; ACSS2; Acyl-activating enzyme; acyl-CoA synthetase short-chain family member 2; cytoplasmic acetyl-coenzyme A synthetase; dJ1161H23.1; Propionate--CoA ligase
Common Name ACSS2
Gene Symbol Acss2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less