missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98715

Invitrogen™ Human ACSM1 (aa 292-360) Control Fragment Recombinant Protein

Catalog No. RP98715
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98715 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98715 Supplier Invitrogen™ Supplier No. RP98715

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61208 (PA5-61208. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACSM1 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy-and 2,3-or 3,4-unsaturated acids (in vitro). This protein functions as GTP-dependent lipoate-activating enzyme that generates the substrate for lipoyltransferase.

Specifications

Accession Number Q08AH1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116285
Name Human ACSM1 (aa 292-360) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACSM1; Acyl-CoA synthetase medium-chain family member 1; acyl-coenzyme A synthetase ACSM1, mitochondrial; Benzoate--CoA ligase; BUCS1; Butyrate CoA ligase; butyrate--CoA ligase 1; butyryl Coenzyme A synthetase 1; butyryl-coenzyme A synthetase 1; LAE; Lipoate-activating enzyme; MACS1; medium-chain acyl-CoA synthetase; middle-chain acyl-CoA synthetase 1; Xenobiotic/medium-chain fatty acid-CoA ligase HXM-B
Common Name ACSM1
Gene Symbol ACSM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less