missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP88962

Invitrogen™ Human ACADM (aa 217-365) Control Fragment Recombinant Protein

Catalog No. RP88962
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP88962 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP88962 Supplier Invitrogen™ Supplier No. RP88962
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82923 (PA5-82923. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects in this gene cause medium-chain acyl-CoA dehydrogenase deficiency, a disease characterized by hepatic dysfunction, fasting hypoglycemia, and encephalopathy, which can result in infantile death. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number P11310
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 34
Name Human ACADM (aa 217-365) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACAD1; Acadm; acyl-CoA dehydrogenase C-4 to C-12 straight chain; acyl-CoA dehydrogenase, C-4 to C-12 straight chain; Acyl-Coenzyme A dehydrogenase C-4 to C-12 straight-chain; acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain; Acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight-chain; acyl-Coenzyme A dehydrogenase, medium chain; AU018656; FLJ18227; FLJ93013; FLJ99884; MCAD; MCADH; medium-chain acyl-CoA dehydrogenase; medium-chain specific acyl-CoA dehydrogenase, mitochondrial; RP4-682C21.1; testicular tissue protein Li 7
Common Name ACADM
Gene Symbol ACADM
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAFAGDIA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less