missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97028

Invitrogen™ Human ABLIM1 (aa 11-65) Control Fragment Recombinant Protein

Catalog No. RP97028
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97028 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97028 Supplier Invitrogen™ Supplier No. RP97028

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58608 (PA5-58608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified.

Specifications

Accession Number O14639
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3983
Name Human ABLIM1 (aa 11-65) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210411C18Rik; 2610209L21Rik; 4833406P10Rik; 9330196J19Rik; ABLIM; ABLIM1; abLIM-1; actin binding LIM protein 1; actin-binding double zinc finger protein; actin-binding double-zinc-finger protein; actin-binding LIM protein 1; Actin-binding LIM protein family member 1; AV079770; AW060987; AW215784; KIAA0059; LIMAB1; Limatin; mKIAA0059; RGD1565768
Common Name ABLIM1
Gene Symbol ABLIM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFYSKSLIRRTGRSPSLQPTRTSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less