missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ABHD8 (aa 201-290) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105097
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111464 (PA5-111464. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The alpha/beta hydrolase superfamily comprise diverse members that are involved in important biochemical processes and related to various diseases. They have unrelated sequences, various substrates, and different kinds of catalytic activities, yet they share the same canonical alpha/beta hydrolase fold, which consists of an eight-stranded parallel alpha/beta structure. They are also characterized by a catalytic triad composed of a histidine, an acid and a nucleophile. Members of this superfamily are often drug targets for treating diseases, such as diabetes, Alzheimer's disease, obesity and blood clotting disorders. The alpha/beta hydrolase domain containing (ABHD) gene subfamily is comprised of 15 mostly uncharacterized members, most of which utilize a serine nucleophile to form the G-X-S-X-G nucleophile elbow. ABHD8 is a 439 amino acid protein that belongs to the AB hydrolase superfamily.Specifications
| Q96I13 | |
| Blocking Assay, Control | |
| 79575 | |
| 100 μL | |
| 0910001L24Rik; AB030191; ABHD8; abhydrolase domain containing 8; abhydrolase domain-containing protein 8; Alpha/beta hydrolase domain-containing protein 8; protein ABHD8 | |
| ABHD8 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ABHD8 (aa 201-290) Control Fragment | |
| RUO | |
| ABHD8 | |
| Unconjugated | |
| Recombinant | |
| LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFKRYAKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPSFCSI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |