missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98356

Invitrogen™ Human ABH1 Control Fragment Recombinant Protein

Catalog No. RP98356
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98356 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98356 Supplier Invitrogen™ Supplier No. RP98356

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60609 (PA5-60609. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. Dioxygenase that repairs alkylated single-stranded DNA and RNA containing 3-methylcytosine by oxidative demethylation. Requires molecular oxygen, alpha-ketoglutarate and iron. May have a role in placental trophoblast lineage differentiation. Has DNA lyase activity and introduces double-stranded breaks at abasic sites. Cleaves both single-stranded DNA and double-stranded DNA at abasic sites, with the greatest activity towards double-stranded DNA with two abasic sites.

Specifications

Accession Number Q13686
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8846
Name Human ABH1 Control Fragment
Quantity 100 μL
Gene Alias 2700073G19Rik; Abh; ABH1; alkB; alkB homolog 1, histone H2A dioxygenase; alkB, alkylation repair homolog 1; alkB, alkylation repair homolog 1 (E. coli); ALKBH; Alkbh1; Alkylated DNA repair protein alkB homolog 1; alkylation repair, alkB homolog; alpha-ketoglutarate-dependent dioxygenase ABH1; DNA 6 mA demethylase; DNA demethylase ALKBH1; DNA lyase ABH1; DNA N6-methyl adenine demethylase; DNA N6-methyl adenine demethylase ALKBH1; DNA oxidative demethylase ALKBH1; hABH; mRNA N(3)-methylcytidine demethylase; Nucleic acid dioxygenase ALKBH1; tRNA N1-methyl adenine demethylase
Common Name ABH1
Gene Symbol ALKBH1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less