missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ABCG8 (aa 299-415) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91216
Description
Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54024 (PA5-54024. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ATP-binding cassette (ABC) transporter genes are involved in the regulation of the amount of dietary cholesterol retained in the body. ABCG8, expressed at high levels in the liver and intestine, normally cooperates with ABCG5 to limit intestinal absorption and promote biliary excretion of sterols. The mutated form of this transporter can lead to sterol accumulation and atherosclerosis or sitosterolemia, a rare autosomal recessive disorder, characterized by hyperabsorption of sterols and the inability to excrete sterols into bile.Specifications
| Q9H221 | |
| Blocking Assay, Control | |
| 64241 | |
| 100 μL | |
| 1300003C16Rik; ABCG8; AI114946; ATP binding cassette subfamily G member 8; ATP-binding cassette sub-family G member 8; ATP-binding cassette, subfamily G (WHITE), member 8; ATP-binding cassette, sub-family G (WHITE), member 8; ATP-binding cassette, subfamily G, member 8; GBD4; MGC142217; sterolin 2; Sterolin2; sterolin-2; STSL | |
| Abcg8 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ABCG8 (aa 299-415) Control Fragment | |
| RUO | |
| ABCG8 | |
| Unconjugated | |
| Recombinant | |
| HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |