missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98784

Invitrogen™ Human ABAT (aa 36-146) Control Fragment Recombinant Protein

Catalog No. RP98784
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98784 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98784 Supplier Invitrogen™ Supplier No. RP98784

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111139 (PA5-111139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Specifications

Accession Number P80404
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 18
Name Human ABAT (aa 36-146) Control Fragment
Quantity 100 μL
Gene Alias (S)-3-amino-2-methylpropionate transaminase; 4-aminobutyrate aminotransferase; 4-aminobutyrate aminotransferase, brain isoform; 4-aminobutyrate aminotransferase, liver isoform; 4-aminobutyrate aminotransferase, mitochondrial; 4-aminobutyrate transaminase; 9630038C02Rik; ABAT; AI255750; beta-AlaAT; beta-alanine oxoglutarate aminotransferase; cb880; ENSMUSG00000051226; fj82a01; FLJ17813; FLJ30272; GABA aminotransferase; GABA AT; GABA T; GABA transaminase; GABA transferase; Gabaat; GABA-AT; Gabat; GABA-T; Gamma-amino-N-butyrate transaminase; Gm9851; hCG1984265; I54; L AIBAT; Laibat; L-AIBAT; mitochondrial 4-aminobutyrate aminotransferase; NPD009; wu:fj82a01; X61497
Common Name ABAT
Gene Symbol ABAT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DVEFDYDGPLMKTEVPGPRSQELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPALLKLIQQPQNASMFVNRPALGILPPENFVEKLRQS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less