missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AARSD1 (aa 311-412) Control Fragment Recombinant Protein

Catalog No. RP93206
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93206 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93206 Supplier Invitrogen™ Supplier No. RP93206

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54624 (PA5-54624. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AARSD1 functions in trans to edit the amino acid moiety from incorrectly charged tRNA(Ala).

Specifications

Accession Number Q9BTE6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80755
Name Human AARSD1 (aa 311-412) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110069E20Rik; 2310044P18Rik; AA589600; AARSD1; Alanyl-tRNA deacylase alaX; alanyl-tRNA editing protein Aarsd1; alanyl-tRNA synthetase domain containing 1; alanyl-tRNA synthetase domain-containing protein 1; Alax; AlaXp-II; MGC2744
Common Name AARSD1
Gene Symbol AARSD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GGVVILHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRMEAQALLQDYISTQSAKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less