missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92050

Invitrogen™ Human 53BP2 (aa 587-693) Control Fragment Recombinant Protein

Catalog No. RP92050
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92050 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92050 Supplier Invitrogen™ Supplier No. RP92050
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54468 (PA5-54468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions. Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo. Inhibits the ability of APPBP1 to conjugate NEDD8 to CUL1, and thereby decreases APPBP1 ability to induce apoptosis. Impedes cell cycle progression at G2/M. Its apoptosis-stimulating activity is inhibited by its interaction with DDX42.

Specifications

Accession Number Q13625
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7159
Name Human 53 BP2 (aa 587-693) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 53 BP2; Apoptosis-stimulating of p53 protein 2; apoptosis-stimulating protein of p53, 2; ASPP2; BBP; Bcl2-binding protein; P PPP1R13A; P53BP2; PPP1R13A; Renal carcinoma antigen NY-REN-51; TP53BP2; transformation related protein 53 binding protein 2; Trp53bp2; tumor protein p53 binding protein 2; tumor protein p53 binding protein, 2; tumor suppressor p53-binding protein 2
Common Name 53 BP2
Gene Symbol TP53BP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less