missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human 53BP2 (aa 587-693) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92050
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54468 (PA5-54468. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Regulator that plays a central role in regulation of apoptosis and cell growth via its interactions. Regulates TP53 by enhancing the DNA binding and transactivation function of TP53 on the promoters of proapoptotic genes in vivo. Inhibits the ability of APPBP1 to conjugate NEDD8 to CUL1, and thereby decreases APPBP1 ability to induce apoptosis. Impedes cell cycle progression at G2/M. Its apoptosis-stimulating activity is inhibited by its interaction with DDX42.Specifications
| Q13625 | |
| Blocking Assay, Control | |
| 7159 | |
| 100 μL | |
| 53 BP2; Apoptosis-stimulating of p53 protein 2; apoptosis-stimulating protein of p53, 2; ASPP2; BBP; Bcl2-binding protein; P PPP1R13A; P53BP2; PPP1R13A; Renal carcinoma antigen NY-REN-51; TP53BP2; transformation related protein 53 binding protein 2; Trp53bp2; tumor protein p53 binding protein 2; tumor protein p53 binding protein, 2; tumor suppressor p53-binding protein 2 | |
| TP53BP2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human 53 BP2 (aa 587-693) Control Fragment | |
| RUO | |
| 53 BP2 | |
| Unconjugated | |
| Recombinant | |
| PQPSKDTLLPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQNQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |