missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human 4E-BP3 (aa 45-98) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100582
Description
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61027 (PA5-61027. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments.Specifications
| O60516 | |
| Blocking Assay, Control | |
| 8637 | |
| 100 μL | |
| 4 EBP3; 4 E-BP3; eIF4E-binding protein 3; EIF4EBP3; eukaryotic initiation factor 4 E-binding protein 3; eukaryotic translation initiation factor 4 E binding protein 3; eukaryotic translation initiation factor 4 E-binding protein 3; NG36 | |
| EIF4EBP3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human 4 E-BP3 (aa 45-98) Control Fragment | |
| RUO | |
| 4 E-BP3 | |
| Unconjugated | |
| Recombinant | |
| LLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |