missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89020096

FOXS1, Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89020096
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89020096 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89020096 Supplier Abnova Corporation Supplier No. H00002307B01P
Only null left

Description

Mouse Polyclonal Antibody

Sequence: MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVAGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

Specifications

Antigen FOXS1
Applications Immunofluorescence, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene forkhead box S1
Gene Accession No. NM_004118.3
Gene Alias FKHL18/FREAC10/MGC4544
Gene Symbols FOXS1
Host Species Mouse
Immunogen FKHL18 (NP_004109.1, 1 a.a. ∼ 330 a.a) full-length human protein.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2307
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Show More Show Less