Learn More
Invitrogen™ EEF2 Monoclonal Antibody (5F5)

Mouse Monoclonal Antibody
Supplier: Invitrogen™ MA549171
Description
Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human HEPG2 whole cell, human Jurkat whole cell, human U20S whole cell, rat PC-12 whole cell, mouse NIH/3T3 whole cell. IHC: human breast cancer tissue, human rectal cancer tissue, human liver cancer tissue, human rectal cancer tissue. ICC/IF: HEPG2 cell. Flow: HEPA1-6 cell, HL-60 cell, NRK cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.Chemical Identifiers
| EEF2 | |
| 500 μg/mL | |
| Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Mouse | |
| RUO | |
| PBS with 4mg trehalose and no preservative | |
| P05197, P13639, P58252 | |
| 13629, 1938, 29565 | |
| A synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR). | |
| Antibody |
| 5F5 | |
| -20°C | |
| Monoclonal | |
| Lyophilized | |
| IgG1 | |
| Human, Mouse, Rat | |
| EEF2 | |
| EEF2; EEF-2; Ef2; EF-2; Elongation factor 2; elongation factor-2; eukaryotic translation elongation factor 2; I79_013848; polypeptidyl-tRNA translocase; SCA26; zef2 | |
| EEF2 | |
| Primary | |
| Antigen affinity chromatography |
Specifications
| EEF2 | |
| Monoclonal | |
| 500 μg/mL | |
| PBS with 4mg trehalose and no preservative | |
| P05197, P13639, P58252 | |
| EEF2 | |
| A synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG1 |
| Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
| 5F5 | |
| Unconjugated | |
| EEF2 | |
| EEF2; EEF-2; Ef2; EF-2; Elongation factor 2; elongation factor-2; eukaryotic translation elongation factor 2; I79_013848; polypeptidyl-tRNA translocase; SCA26; zef2 | |
| Mouse | |
| Antigen affinity chromatography | |
| RUO | |
| 13629, 1938, 29565 | |
| -20°C | |
| Lyophilized |