missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ CD229 Polyclonal Antibody
GREENER_CHOICE

Catalog No. pipa595601
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595601 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595601 Supplier Invitrogen™ Supplier No. PA595601
Only null left

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - IHC: mouse spleen tissue, mouse spleen tissue, rat spleen tissue, rat spleen tissue. Flow: Jurkat cell, Daudi cell, U937 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

CD229 (Ly9) is a cell surface receptor of the CD150 family, which includes also e.g. CD48 and CD224. Receptors of this family regulate cytokine production and cytotoxicity of lymphocytes and NK cells. High levels of CD229 are found on T and B cells, where its expression increases during their maturation. It is absent on granulocytes, bone marrow-derived dendritic cells, platelets and erythrocytes. CD229 has been also reported on mouse monocytes and NK cells. CD229 interacts homophilically through its N-terminal domain and localizes to the contact site between T cells and antigen presenting B cells during antigen-dependent immune synapse formation.

Specifications

Antigen CD229
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene Ly9
Gene Accession No. Q01965, Q9HBG7
Gene Alias AI893573; CD229; CDABP0070; Cell surface molecule Ly-9; hly9; Lgp100; LY9; Ly-9; Lymphocyte antigen 9; mLY9; RP11-312J18.1; Signaling lymphocytic activation molecule 3; SLAM family member 3; SLAMF3; T100; T-lymphocyte surface antigen Ly-9
Gene Symbols Ly9
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 17085, 289227, 4063
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less