missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Ataxin 1 Monoclonal Antibody (N76/8), PE
GREENER_CHOICE

Catalog No. PIMA545665
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA545665 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA545665 Supplier Invitrogen™ Supplier No. MA545665
Only null left

Mouse Monoclonal Antibody

Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). 1 μg/mL of MA5-45665 was sufficient for detection of Ataxin-1 in 20 μg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody. Detects approximately 85kDa. This antibody was formerly sold as clone S76-8.

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the 'pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.

Specifications

Antigen Ataxin 1
Applications Immunohistochemistry, Western Blot, Immunocytochemistry
Classification Monoclonal
Clone N76/8
Concentration 1 mg/mL
Conjugate PE
Formulation 2.48mM MES, 95.46mM phosphate with 2mM EDTA and no preservative; pH 7.4
Gene ATXN1
Gene Accession No. P54253, P54254, Q63540
Gene Alias 2900016G23Rik; alternative ataxin1; ataxin 1; Ataxin1; ataxin-1; Atx1; Atx-1; Atx-1-PB; Atxn1; C85907; CG4547; CG4547-PB; D6S504E; dAtx-1; Dmel\CG4547; Dmel_CG4547; ENSMUSG00000074917; Gm10786; OTTHUMP00000016065; SCA1; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Gene Symbols ATXN1
Host Species Mouse
Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1.
Purification Method Protein G
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20238, 25049, 6310
Target Species Human, Mouse, Rat
Content And Storage 4°C
Product Type Antibody
Form Liquid
Isotype IgG2b
Show More Show Less