missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89004580

zinc finger protein 500, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004580
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89004580 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89004580 Supplier Abnova Corporation Supplier No. H00026048A01
Only null left

Description

Mouse polyclonal antibody raised against a partial recombinant ZNF500.

Sequence: QRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPGAKA

Specifications

Antigen zinc finger protein 500
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant ZNF500.
Formulation 50% glycerol
Gene ZNF500
Gene Accession No. NM_021646
Gene Alias ZKSCAN18
Gene Symbols ZNF500
Host Species Mouse
Immunogen ZNF500 (NP_067678, 372 a.a. ∼ 480 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 26048
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less