missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89006470

zinc finger protein 22 (KOX 15), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89006470
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89006470 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89006470 Supplier Abnova Corporation Supplier No. H00007570B01
Only null left

Description

Mouse polyclonal antibody raised against a full-length human ZNF22 protein.

Sequence: MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQKIHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR

Specifications

Antigen zinc finger protein 22 (KOX 15)
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a full-length human ZNF22 protein.
Formulation No additive
Gene ZNF22
Gene Accession No. NM_006963.3
Gene Alias HKR-T1/KOX15/ZNF422/Zfp422
Gene Symbols ZNF22
Host Species Mouse
Immunogen ZNF22 (NP_008894.2, 1 a.a. ∼ 224 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7570
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less