missing translation for 'onlineSavingsMsg'
Learn More

transportin 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TNPO2.

Supplier: Abnova Corporation H00030000A01

Catalog No. 89-004-610

Quantity

Description

Sequence: MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP

Specifications

Antigen	transportin 2
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant TNPO2.
Gene	TNPO2
Gene Alias	FLJ12155/IPO3/KPNB2B/TRN2
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	30000
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_013433
Gene Symbols	TNPO2
Immunogen	TNPO2 (NP_038461, 201 a.a. ∼ 300 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human, Rat
Form	Serum

Product Suggestions

Description