missing translation for 'onlineSavingsMsg'
Learn More
Learn More
stress-induced-phosphoprotein 1, Mouse, Clone: 1E3, Abnova™
Description
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM
Sequence: TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Specifications
Specifications
| Antigen | stress-induced-phosphoprotein 1 |
| Applications | ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot |
| Classification | Monoclonal |
| Clone | 1E3 |
| Conjugate | Unconjugated |
| Description | Mouse monoclonal antibody raised against a partial recombinant STIP1. |
| Formulation | PBS with no preservative; pH 7.4 |
| Gene | STIP1 |
| Gene Accession No. | NM_006819 |
| Gene Alias | HOP/IEF-SSP-3521/P60/STI1/STI1L |
| Show More |