missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001198

stress-induced-phosphoprotein 1, Mouse, Clone: 1E3, Abnova™

Catalog No. 89001198
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89001198 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89001198 Supplier Abnova Corporation Supplier No. H00010963M11
Only null left

Description

Mouse monoclonal antibody raised against a partial recombinant STIP1.

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM

Sequence: TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

Specifications

Antigen stress-induced-phosphoprotein 1
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant STIP1.
Formulation PBS with no preservative; pH 7.4
Gene STIP1
Gene Accession No. NM_006819
Gene Alias HOP/IEF-SSP-3521/P60/STI1/STI1L
Gene Symbols STIP1
Host Species Mouse
Immunogen STIP1 (NP_006810.1, 445 a.a. ∼ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10963
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less