missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89022357

SFN, Mouse, Clone: 1E6, Abnova™

Catalog No. 89022357
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89022357 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89022357 Supplier Abnova Corporation Supplier No. H00002810M05
Only null left

Description

Mouse monoclonal antibody raised against a full-length recombinant SFN.

Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKAETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Specifications

Antigen SFN
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1E6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant SFN.
Formulation PBS with no preservative; pH 7.4
Gene SFN
Gene Accession No. BC000329
Gene Alias YWHAS
Gene Symbols SFN
Host Species Mouse
Immunogen SFN (AAH00329.1, 1 a.a. ∼ 248 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2810
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less